Protein Info for SOA0019 in Shewanella oneidensis MR-1

Annotation: ISSod9, DNA-invertase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF00239: Resolvase" amino acids 3 to 135 (133 residues), 158.4 bits, see alignment E=2e-50 PF02796: HTH_7" amino acids 138 to 181 (44 residues), 39.9 bits, see alignment 5.7e-14 PF13384: HTH_23" amino acids 153 to 179 (27 residues), 26.6 bits, see alignment 5.9e-10

Best Hits

Swiss-Prot: 62% identical to GIN_BPMU: Serine recombinase gin (gin) from Escherichia phage Mu

KEGG orthology group: None (inferred from 100% identity to son:SO_A0170)

MetaCyc: 61% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8CME3 at UniProt or InterPro

Protein Sequence (185 amino acids)

>SOA0019 ISSod9, DNA-invertase (NCBI ptt file) (Shewanella oneidensis MR-1)
MLIGYARVSTQDQHLELQREALLKAGCEKVFEDTISGTRADRLGLSKALEILREGDTLVV
WKLDRLGRSVKQLVELVSDLHKQNVQFKSLTDSIDTGTPSGRFFFHVMASLAEMERDLIV
ERTRAGLDVARQLGRKGGRKPKMTDSKIESAKKLLASGVPPKDVAKNLGVSVPTLYRWLP
ASAHA