Protein Info for SO4755 in Shewanella oneidensis MR-1

Annotation: ParB family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF02195: ParB_N" amino acids 33 to 130 (98 residues), 129.2 bits, see alignment E=9.5e-42 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 36 to 211 (176 residues), 199.9 bits, see alignment E=1.6e-63 PF17762: HTH_ParB" amino acids 133 to 231 (99 residues), 112.9 bits, see alignment E=1.1e-36 PF23552: ParB_C" amino acids 243 to 292 (50 residues), 78.1 bits, see alignment 4.2e-26

Best Hits

Swiss-Prot: 62% identical to PARB_PSEPU: Probable chromosome-partitioning protein ParB (parB) from Pseudomonas putida

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to son:SO_4755)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8B2 at UniProt or InterPro

Protein Sequence (292 amino acids)

>SO4755 ParB family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTLKKRGLGKGLDALLSHSHAANKKQTEEVAVVEKKEELIHLDLDLLQPGKYQPRKDMSP
EALEELAHSIRNQGIIQPIVVRPVSETQYEIIAGERRWRASQLAGVDKIPCIVKPVPDEA
AVAIALIENIQREDLNAMEEAIALQRLMQEFELTHQQVADVVGKSRASVSNLLRLNGLNE
PVKRLLEYGDIDMGHARALLAIEGEEQTNLARLVAAKELTVRETERLINQTLNPPKPVET
TTKDQDVCRLEQQLIERLGAKVSIAHSSKGKGKIVINYQNLAELDGILSKIR