Protein Info for SO4743 in Shewanella oneidensis MR-1

Annotation: TonB-dependent receptor, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 PF07715: Plug" amino acids 43 to 140 (98 residues), 69.5 bits, see alignment E=3.3e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 45 to 690 (646 residues), 278.8 bits, see alignment E=5.2e-87 PF00593: TonB_dep_Rec_b-barrel" amino acids 252 to 660 (409 residues), 211.7 bits, see alignment E=3.8e-66

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to son:SO_4743)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8C4 at UniProt or InterPro

Protein Sequence (690 amino acids)

>SO4743 TonB-dependent receptor, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MAMPVMAEAPNDANIERINVTGRTFNDYKVGSASGAMRGDIDLMDTPQSVNVIPDFVTDE
QLATNLAEVLVNDSSVTAGTTRWNRQVFSIRGFELDSGNGYLINGHQQWSHYVQPIETLQ
QVEVLKGPSSMLYGQSGPGGLVNMVTKKPTYDSMLDLGFDTDGYGSTRAQLDAGGSLNEA
QSIRYRGVLVKQDTKYWREYSTTDENQERDRWLGYLNLEFDISDDLLLSVKYDHTQDKAG
IDAGGWLDKQGNVIGERKTVWDAPWAFTDNTVSNLGADLTWQMTNDWKVKVGYNDQQFNR
QRLDSAPSLIEGSEDPFKDGYNIKPFDRYDDWQHKTAYVDFTGEFSLAGMEHQFLIGANY
LDYFYQQQIQKGKSQRVIPGQPIIQQDLDYHQGQLSNPSEYKYYGFYLQDLMTLNEQWKL
LAGVRYDEQKKDTAGGNSYAVSPKFGVIYSPMDNGSIYVNYSKSFTPQGSVTSSEDVNQG
ANLKPEYGTQYELGTKWELFNDSLLLTAALFDITVSNVTTVLDIPVTSDGDKTITTQGGE
QHHRGFEVGAQGQLGDSWFVTSSMMYLDAEYNTGAGKIGGKNLDGKTPIDAPKWSANIWT
RYEVTDNFAMNFGAIYVGERFANDVNTITKDGYVRFDVGAAYTTDIMGKDVSIRANVRNL
FDTEYLDGGSDKMVTIGQDRNFSVALEAKF