Protein Info for SO4739 in Shewanella oneidensis MR-1

Name: menB
Annotation: naphthoate synthase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01929: naphthoate synthase
  • amino acids 22 to 296 (275 residues), 388.7 bits, E=6.9e-121
• PF00378: ECH_1
  • amino acids 34 to 294 (261 residues), 163.1 bits, E=8e-52
• PF16113: ECH_2
  • amino acids 37 to 226 (190 residues), 41.8 bits, E=1e-14

Best Hits

Swiss-Prot: 66% identical to MENB_MYCTU: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01661, naphthoate synthase [EC: 4.1.3.36] (inferred from 100% identity to son:SO_4739)

MetaCyc: 66% identical to naphthoate synthase monomer (Mycobacterium tuberculosis H37Rv)
Naphthoate synthase. [EC: 4.1.3.36]

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (8/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.36

Sequence Analysis Tools

See Q8E8C7 at UniProt or InterPro

Protein Sequence (300 amino acids)

>SO4739 naphthoate synthase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTKPVSDTFDPTLWDQVNGFNFTDITYHRAKAHGTVRIAINRPDCLNAFRPKTVDELYIA
LDHARQWSDVGCALLTGNGPSAKGQYSFSSGGDQRIRGKDGYKYEGAEEGKADLARMGRL
HILEVQRLIRFMPKVVIAVVPGWAVGGGHSLHVVCDLTLASKEHAIFKQTDPDVASFDSG
YGSAYLAKMIGQKRAREIFFCGFNYSADEAFAMGMVNKSVPHAELEVEALRWAKEINSKS
PTAMRMLKYGFNMTDDGMVGQQLFAGEATRLAYASAEAQEGRDAFLEKRDQDFSAFPWHY