Protein Info for SO4720 in Shewanella oneidensis MR-1

Annotation: ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 46 to 222 (177 residues), 40.3 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 38% identical to ANTRP_HALVD: Probable anion ABC transporter permease protein HVO_1887 (HVO_1887) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K05773, putative tungstate transport system permease protein (inferred from 100% identity to son:SO_4720)

Predicted SEED Role

"ABC-type tungstate transport system, permease protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8E5 at UniProt or InterPro

Protein Sequence (235 amino acids)

>SO4720 ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSEGWLALLQQALSLLFSLDPDVWSIISVSFSVSFAALLITLVPSMVLGFVLAFAHFPGK
WFVTNLVQTLQSIPTVVIGLLVYLILTRNGPLGDLKWLFTQEGMILGQMLICAPVMIAMS
QAAFTSVDRRAWETSRTLGASWAGAVWAVCRELRMPLLLAIVAAFSRILTEVGCSMMVGG
NILNVTRNIPTAIALETSKGDFAQAIALGLVLLILALILNFALGSLRGKETPRSH