Protein Info for SO4718 in Shewanella oneidensis MR-1

Annotation: sigma-54 dependent response regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00072: Response_reg" amino acids 17 to 126 (110 residues), 89.3 bits, see alignment E=6.8e-29 PF00158: Sigma54_activat" amino acids 154 to 319 (166 residues), 228.5 bits, see alignment E=1.4e-71 PF14532: Sigma54_activ_2" amino acids 155 to 324 (170 residues), 65 bits, see alignment E=3.2e-21 PF00004: AAA" amino acids 178 to 303 (126 residues), 24 bits, see alignment E=1.6e-08 PF07728: AAA_5" amino acids 178 to 296 (119 residues), 32 bits, see alignment E=4e-11 PF02954: HTH_8" amino acids 411 to 451 (41 residues), 34.2 bits, see alignment 6.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4718)

Predicted SEED Role

"Sigma-54 dependent response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8E7 at UniProt or InterPro

Protein Sequence (460 amino acids)

>SO4718 sigma-54 dependent response regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQIDNNLKPLPSAVSVLIVDDEPGMRSFLNKALSKKFALVETAGSIEDAEQLRSRCHFD
LLIVDIRLPGRSGIEWSEALDEQGRRSDVIFMTGYADLEVAIKALRAGASDFIMKPFHLE
QMMSAVDRCIERRLLRRENLMLRREVSIGYSSTIIGSSDAMKSVKQVIERVAPTNAVVLI
QGESGTGKELVARQLHLLSGRQGPFVPVNCGSIAPELLESELFGHTAGAFTGAKGNREGL
FSFASGGTIFLDEIGEMPLKMQTALLRVLEQKAIRPVGSEKEVNIDVRVIAATNRTLVDE
VEAGNFRRDLYYRLNVLDILIPPLRDRPEDVVELTHHFTRQLAAELGVREVVWSHEDMVK
LQQHEWPGNIRELRNMIERCILLGKPPAEYWKQQVKTESLASQGYPLDWPLKEVEKHHVT
SVVDLHSGNKSAAARDLGVSRKTLDRKYKEWFGVSDEQEF