Protein Info for SO4710 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details PF04403: PqiA" amino acids 100 to 219 (120 residues), 56.7 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4710)

Predicted SEED Role

"conserved protein of unknown function; putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8F5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>SO4710 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MHLRRLRPYTELTFILGSVMNNVRKSILPILVILLSLALLIPGVTQPILSISGSIDKAKL
TEQGIEQVARSFDEDLGRGSARGMLNMVSGLLGLHTLKGEVQVLQQTRSIWSTVTELYNT
GNGLVAGLVMLFSIIIPAIKLSLMLAQQSVSSIALQWRIHHIVDLLAKWSMADVFVVALI
ITFLAGNASGGMGEMLKTQAQFESGFYFFTAYCILSIVSGYLVRRPTPIL