Protein Info for SO4708 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 61 to 79 (19 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 34 to 296 (263 residues), 160.8 bits, see alignment E=2e-51

Best Hits

Swiss-Prot: 100% identical to Y4708_SHEON: UPF0324 membrane protein SO_4708 (SO_4708) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_4708)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8F7 at UniProt or InterPro

Protein Sequence (316 amino acids)

>SO4708 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNFSSIFSQLKDPHRLIFICAALLCLTPFMSSPMALVLGFTLASLGWVPKDWNIAALTKK
LLSYSIIGLGFGINLTAAIEASSHNLGLIIGSIIFTLILGFIVTRALKFDPITGHLIASG
TAICGGSAIAAVAPAVNAKADQTATALACVFVLNSVALFLFPALGHLLNMSQYDFGVWSA
IAIHDTSSVVGAASAYGDEALKTATTIKLARALWIIPIALVSALIFGGDKRKLNLPYFIG
FYCLAIAIAHWLPQFQPLYNTLFMVSKHTLVLCLFLIGAGITVQKMRASGPKPLLLGVIL
WMAIGVTSLAYILYFQ