Protein Info for SO4692 in Shewanella oneidensis MR-1

Annotation: AcrB/AcrD/AcrF family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1044 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 339 to 359 (21 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 470 to 493 (24 residues), see Phobius details amino acids 538 to 556 (19 residues), see Phobius details amino acids 870 to 888 (19 residues), see Phobius details amino acids 895 to 915 (21 residues), see Phobius details amino acids 921 to 942 (22 residues), see Phobius details amino acids 970 to 990 (21 residues), see Phobius details amino acids 1002 to 1024 (23 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 1024 (1024 residues), 1331.9 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1038 (1038 residues), 1735.3 bits, see alignment E=0 PF03176: MMPL" amino acids 297 to 517 (221 residues), 36.7 bits, see alignment E=3.6e-13

Best Hits

Swiss-Prot: 66% identical to ACRB_ECOLI: Multidrug efflux pump subunit AcrB (acrB) from Escherichia coli (strain K12)

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 67% identity to abo:ABO_0964)

MetaCyc: 61% identical to multidrug efflux pump RND permease MdtF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-359; TRANS-RXN-367

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8H2 at UniProt or InterPro

Protein Sequence (1044 amino acids)

>SO4692 AcrB/AcrD/AcrF family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MARFFIDRPIFAWVIALIIMLAGVLSIRTLPVSQYPSIAPPTVVISANYPGASAKIVEDS
VTQVIEQRMKGIDHLRYIASTSDSFGNAEITLTFNAEADPDIAQVQVQNKLQGAMTLLPQ
EVQAQGVDVNKSSSGFLMVLGFVSTDGSLDKGDIADYVGANVQDPMSRVPGVGEIQLFGA
QYAMRIWLDPLKLTQYNLTSLEVISAIRAQNAQVSAGQLGGTPSIQGQELNATVSAQSRL
QTPEEFRKIILKSDTSGANVFLGDVARVELGSESYAVVSFYNGKPATGLAIKLATGANAL
DTAEAVRDKVEELRPFFPQGLDVVYPYDTTPFVEKSIEGVVHTLLEAIVLVFVIMYLFLQ
NFRATLIPTIAVPVVLLGTFAILSATGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVM
SEEGLSPLEATRKSMDQITGALVGIGLTLSAVFVPMAFMSGSTGVIYRQFSITIVSAMAL
SVLVALILTPALCATMLKPVQKGHGHIETGFFGWFNRNFDRLTNRYESSVAGIVKRGFRV
MMIYVALVVAVGWIFMRMPTAFLPDEDQGILFTQAILPTNSTQESTLKVLDKVSDHFMAE
EGVRSVFSVAGFSFAGQGQNMGIAFVGLKDWSEREAPGMDVQSIAGRAMGAFSQIKDAFV
FAFVPPAVIELGTANGFDMYLQDKNGQGHDKLIAARNQLLGMAAQNPNLMGVRPNGQEDA
PIYQLHIDHAKLSALGVDIANVNSVLATAWGGSYVNDFIDRGRVKKVFVQGDAQYRMQPE
DLNTWYVRNNKGDMVPFSAFATGSWEYGSPRLERFNGLPAVNIQGATAPGFSTGAAMTIM
EDLVKQLPPGFGIEWNGLSYEERLSGNQAPALYALSILVVFLVLAALYESWSVPFAVILV
VPLGIIGALLAMNGRGLPNDVFFQVGLLTTVGLATKNAILIVEFAKEFYEKGAGLVEATL
HAVRVRLRPILMTSLAFGLGVVPLAISTGVGSGSQNAIGTGVLGGMMSSTFLGIFFVPLF
FVIVERIFSKRERKAKEKNPTSTD