Protein Info for SO4689 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 44 to 61 (18 residues), see Phobius details amino acids 68 to 98 (31 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF09335: VTT_dom" amino acids 63 to 178 (116 residues), 82.5 bits, see alignment E=1.8e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4689)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8H5 at UniProt or InterPro

Protein Sequence (219 amino acids)

>SO4689 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKRLYKAMFIVFILLVLMFASQQGLFEHVTNSNWVAHFIKAEGNYALMALLAVGALFTAV
GGPRQVIAFVFGFALGGIYGGLFSTLAALLGCVLVFYTARLTIRSSLQRRFGHRLQKFEA
LIIHRTWLKVLMIRLLPVGSNLLTNLFAGATHISPGGFLFGSMLGYLPQMLIFSFAGAGI
GLADHNQLWISIGLFIVSSLIGAYLYRSSLRKQVDELEH