Protein Info for SO4672 in Shewanella oneidensis MR-1

Name: glpE
Annotation: glpE protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF00581: Rhodanese" amino acids 9 to 98 (90 residues), 75.7 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 100% identical to GLPE_SHEON: Thiosulfate sulfurtransferase GlpE (glpE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 100% identity to son:SO_4672)

MetaCyc: 49% identical to thiosulfate sulfurtransferase GlpE (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]; 2.8.1.- [EC: 2.8.1.1]

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8J2 at UniProt or InterPro

Protein Sequence (101 amino acids)

>SO4672 glpE protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSSFKHLSVNQLVQMTEAKSVQIVDIRDGNSFNNGHIDGAFNLNNENLAHFIGQADMDRP
LVVVCYHGISSQNAAQYLCEQGFDDVYSLDGGFSAWHEANA