Protein Info for SO4670 in Shewanella oneidensis MR-1

Name: elbB
Annotation: enhancing lycopene biosynthesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details

Best Hits

Swiss-Prot: 44% identical to GAL3A_MOUSE: Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial (Gatd3a) from Mus musculus

KEGG orthology group: None (inferred from 100% identity to son:SO_4670)

Predicted SEED Role

"Sigma cross-reacting protein 27A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8J4 at UniProt or InterPro

Protein Sequence (218 amino acids)

>SO4670 enhancing lycopene biosynthesis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKIAVLLSGCGVFDGTEIHESVLTLLSLSKAGAQYQCFAPDINQMHVVNHFTGEADNTA
TRNVLVESARIARGDIKATTELDITAFDALIIPGGFGAAKNLCNFATNGSECEVHPLVTD
FINEFILAKKPVGFICIAPMMIPRLYGHGAKGTIGNDVDTVAAFNLMGGSHHAATVHDIV
VDEANKIVSTPAYMLAGNIAEAHSGIEKLVAKVLQLVK