Protein Info for SO4654 in Shewanella oneidensis MR-1

Name: cysW-2
Annotation: sulfate ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 12 to 274 (263 residues), 314 bits, see alignment E=9e-98 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 18 to 277 (260 residues), 402.6 bits, see alignment E=7.9e-125 PF00528: BPD_transp_1" amino acids 84 to 267 (184 residues), 45.5 bits, see alignment E=3.7e-16

Best Hits

Swiss-Prot: 48% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to son:SO_4654)

MetaCyc: 48% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8K9 at UniProt or InterPro

Protein Sequence (283 amino acids)

>SO4654 sulfate ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNTLSPATNHATTEAPWIKWSLIGLALSFLALFLVLPLAVVLYGAFEAGINVWWQAITDP
DALAAIRLTLLVLIIVVPTNAIFGVAIAWAIAKFEFRGKTLLISIIDMPFAISPVVVGLI
FVILFGAQGWFGPWLAAHDLKVIFAVPGIIIVIMFGTLPFVARELIPLMQQQGKDEEEAS
LTLGANGLKTFWYVTLPNIKWGLLYGVILCNARAMGEFGAVAVVSGRIRGETNTMPLHIE
VLYNEYMFTAAFAVSSLLTGLALVTIVLKSMVEWKDERKHKTN