Protein Info for SO4653 in Shewanella oneidensis MR-1

Name: cysT-2
Annotation: sulfate ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 28 to 59 (32 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 27 to 287 (261 residues), 311.1 bits, see alignment E=6.7e-97 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 28 to 291 (264 residues), 420.3 bits, see alignment E=3.3e-130 PF00528: BPD_transp_1" amino acids 95 to 286 (192 residues), 65.9 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 49% identical to CYST_SALTY: Sulfate transport system permease protein CysT (cysU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to son:SO_4653)

MetaCyc: 49% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8L0 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SO4653 sulfate ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRFPLREAAYLFDSPWNKNMGKAVMKSVLPGFGITLGFSVLYLSLLFLLPVAGLILFTLQ
MSWADFWVAISHPQVVASYKLSFAASFIGATINAVFGTLVAWVLVRYQFLGKKVVDALVD
LPFALPTAVAGIALVTLYSTTGWVGQYLYLWGIKVAYSEIGVVIALTYIGLPFVVRTVQP
VLADFSKELEEASASLGASRFTTIKRVILPAVLPALLTGYALAFARAVGEYGSVIFISGN
LPYRTEITPLLIVSKAEQYDYNGAAAIGVVMLAAAFILLLIINSLQWWASKRG