Protein Info for SO4617 in Shewanella oneidensis MR-1

Name: dinF
Annotation: DNA-damage-inducible protein F (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 98 to 124 (27 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details PF01554: MatE" amino acids 27 to 187 (161 residues), 88.7 bits, see alignment E=1.8e-29 amino acids 254 to 403 (150 residues), 49.1 bits, see alignment E=2.7e-17 TIGR00797: MATE efflux family protein" amino acids 27 to 415 (389 residues), 264.6 bits, see alignment E=7.3e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4617)

Predicted SEED Role

"DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8P4 at UniProt or InterPro

Protein Sequence (455 amino acids)

>SO4617 DNA-damage-inducible protein F (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTAKSTALALLFNGTKNRQLFALALPMILSNITVPLLGLVDTAVIGHLSDAYYLGGVAL
GSTIITLIIWLLGFLRMATTGLVAQAYGANDINAQLKLLVQGAMLATGLGIAMILLQVPL
LSLALSFSEASVEVERYCREYFQIRIWSTPFALLNLVMLGWLLGRQQPKAAMWQLIFANV
ANIILDVLFVLGFGWGVKGAALASVFADITAFSVALYMVLQQVKLIPNYPFAEIRAHIRF
TGFGQLLRLNSDIFIRSLCLQTAFAFMTFHGAGLGDNTVAANAVLLNLLLLISYALDGIA
YYAEAEVGKAYGQKRAQQLHEAVVLAWCWSAITALGFTLIFSLWGSHIIELLTSIDEVRT
TAQIYLIWLVLLPLWSFSSYLFDGVYIGAAQGKVMRNSMIIATFGAFFPTWYLLQSLLPS
EQANHALWAAMTAFMLMRSLTLAAHYRFSKTFIVS