Protein Info for SO4591 in Shewanella oneidensis MR-1

Name: cymA
Annotation: tetraheme cytochrome c (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 33% identical to NAPC_HAEIN: Cytochrome c-type protein NapC (napC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to son:SO_4591)

MetaCyc: 100% identical to quinol--cytochrome-c reductase CymA (Shewanella oneidensis MR-1)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Membrane anchored tetraheme cytochrome c, CymA"

MetaCyc Pathways

sn-glycerol 3-phosphate anaerobic respiration (3/3 steps found)
aerobic respiration I (cytochrome c) (3/4 steps found)
aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
formate to nitrite electron transfer (2/3 steps found)
Fe(II) oxidation (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8S0 at UniProt or InterPro

Protein Sequence (187 amino acids)

>SO4591 tetraheme cytochrome c (NCBI ptt file) (Shewanella oneidensis MR-1)
MNWRALFKPSAKYSILALLVVGIVIGVVGYFATQQTLHATSTDAFCMSCHSNHSLKNEVL
ASAHGGGKAGVTVQCQDCHLPHGPVDYLIKKIIVSKDLYGFLTIDGFNTQAWLDENRKEQ
ADKALAYFRGNDSANCQHCHTRIYENQPETMKPMAVRMHTNNFKKDPETRKTCVDCHKGV
AHPYPKG