Protein Info for SO4511 in Shewanella oneidensis MR-1

Annotation: formate dehydrogenase, C subunit, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 92 to 114 (23 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details amino acids 213 to 229 (17 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 129 to 333 (205 residues), 161.3 bits, see alignment E=1.5e-51 PF01292: Ni_hydr_CYTB" amino acids 131 to 304 (174 residues), 78.4 bits, see alignment E=3.1e-26

Best Hits

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 100% identity to son:SO_4511)

Predicted SEED Role

"Formate dehydrogenase -O, gamma subunit (EC 1.2.1.2)" in subsystem Anaerobic respiratory reductases or Formate hydrogenase (EC 1.2.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8Y9 at UniProt or InterPro

Protein Sequence (342 amino acids)

>SO4511 formate dehydrogenase, C subunit, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLNKQLNKSLRSLFALMVLVMGLGLGSVMSASPVQASDQQSSQQQAKAQTSEADLWRAVK
SGETGYTTAEGVEAGVLINVAGNQGKELRNQYITPIMALAVTGVFGVFLLFYLVNGPSKL
SHGFSGKMVVRWSKADLWIHWIMAISCLVLMFTGLTIMLGKHVVQELLGPDIWAPLIYGS
KTVHDWAGPIFIVSWIVCVVKWMPLQTFKMYDLKWFLVVGGYINFGPFKGKHPDSGFANA
GEKMWFWTLTLFGLFISVSGIMLVLPGLDLPREASMAALLIHSISAVILIAFTIVHIWMA
TVLSEGGMECMKSGYCDENWAIQHHNLWYDEIKANGSLRYKD