Protein Info for SO4488 in Shewanella oneidensis MR-1

Annotation: sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details PF02518: HATPase_c" amino acids 330 to 437 (108 residues), 53.2 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4488)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E907 at UniProt or InterPro

Protein Sequence (438 amino acids)

>SO4488 sensor histidine kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MYSLKAYLTRNLLITLTCAMALLLYLLFQGIQILTQDFVASRLQHDTDSLISALEPQVDG
TWSLNADRLPNVYHRVNSGHYFAIQIGEQQLRSRSLFDHAVTLPSLKVGEQQQATQYVGQ
EHWLMLSQTIVKNGQSIRLWVTEDISSLEQTQLRFLGFATTMVLLTILILLFAQHQLLKR
GFKPLEKIPEAIRQMRLQGREIDTQQTPSEITPLIAEIDRLVNQLGQRVQRSRNALGNLA
HEMKRPLQGLQSYLDSQAPEQRHEGSKVLAELHHIIERELKRTKIVGLSTPGRFTVLNDD
LSPLIQVMQRIYPHRRISCHYDKDLVMPFDRDDLLELLGNLLDNACKHGHKHIELCIMQQ
SVPNPGYGIIASDDGEGVSDAAMSIIVERGIRLDESIQGHGLGLSICKDIVDSYQGELHF
NHAKQGGLEAKVFLPLPN