Protein Info for SO4472 in Shewanella oneidensis MR-1

Name: ntrC
Annotation: nitrogen regulation protein NR(I) (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 TIGR01818: nitrogen regulation protein NR(I)" amino acids 7 to 468 (462 residues), 769.5 bits, see alignment E=5.9e-236 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 91.3 bits, see alignment E=1.6e-29 PF00158: Sigma54_activat" amino acids 142 to 309 (168 residues), 239.7 bits, see alignment E=5.2e-75 PF14532: Sigma54_activ_2" amino acids 143 to 313 (171 residues), 61.7 bits, see alignment E=3.5e-20 PF07724: AAA_2" amino acids 162 to 279 (118 residues), 29.1 bits, see alignment E=3.4e-10 PF07728: AAA_5" amino acids 166 to 283 (118 residues), 32 bits, see alignment E=4.2e-11 PF25601: AAA_lid_14" amino acids 315 to 393 (79 residues), 85.3 bits, see alignment E=7.2e-28 PF02954: HTH_8" amino acids 430 to 468 (39 residues), 53.5 bits, see alignment 5.7e-18

Best Hits

Swiss-Prot: 70% identical to NTRC_SALTY: DNA-binding transcriptional regulator NtrC (glnG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to son:SO_4472)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E922 at UniProt or InterPro

Protein Sequence (471 amino acids)

>SO4472 nitrogen regulation protein NR(I) (NCBI ptt file) (Shewanella oneidensis MR-1)
MRISEQVWILDDDSSIRWVLEKALQGAKLSTASFAAAESLWQALEISQPRVIVSDIRMPG
TDGLTLLERLQIHYPHIPVIIMTAHSDLDSAVSAYQAGAFEYLPKPFDIDEAISLVERAL
THATEQSPTPVAQETQVKTPEIIGEAPAMQEVFRAIGRLSRSSISVLINGQSGTGKELVA
GALHKHSPRKDKPFIALNMAAIPKDLIESELFGHEKGAFTGAANVRQGRFEQANGGTLFL
DEIGDMPLDVQTRLLRVLADGQFYRVGGHSAVQVDVRIIAATHQDLEQLVLKGGFREDLF
HRLNVIRIHLPPLSQRREDIPQLASHFLASAAKEIGVEAKILTKETAAKLSQLPWPGNVR
QLENTCRWLTVMASGQEILPQDLPPELLKEPTSINPMAKGSQDWQSALTEWIDQKLSEGN
SDLLTEVQPAFERILLETALRHTQGHKQEAAKRLGWGRNTLTRKLKELSMD