Protein Info for SO4471 in Shewanella oneidensis MR-1

Name: ntrB
Annotation: nitrogen regulation protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF08448: PAS_4" amino acids 7 to 98 (92 residues), 27.6 bits, see alignment E=5.8e-10 PF00512: HisKA" amino acids 129 to 184 (56 residues), 56.8 bits, see alignment E=3.8e-19 PF02518: HATPase_c" amino acids 231 to 344 (114 residues), 75.7 bits, see alignment E=8e-25

Best Hits

Swiss-Prot: 54% identical to NTRB_VIBAL: Sensory histidine kinase/phosphatase NtrB (ntrB) from Vibrio alginolyticus

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 100% identity to son:SO_4471)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E923 at UniProt or InterPro

Protein Sequence (348 amino acids)

>SO4471 nitrogen regulation protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDKETLLNHLVTAVLVIDKDLKPCYANAAAEQLLGVGSHRLVEQALPEHYQALGVDTQLL
SDAVKAGQSLTVNTATLVTLDAQHHTVDLTLIPLEDEALLSLLELRQVDQQRRIHQQLSQ
DAQQQAAQFLVRNLAHEIKNPLGGLRGAAQLLSRELDDPAQKEFTNLIIEQADRLRSLVD
RLLGPQRPTQHSLHNIHQVVQKVYKLVEIALPANIQLKRDYDPSIPDIEMDPDQMQQAVL
NILQNAVQALEHTDGEILIRTRTQHQVTIGSQRHKLVLTLSIIDNGPGIPPELMDTLFYP
MVTSREQGSGLGLSIAHNIARLHSGRIDCVSSPGHTEFIISLPILSAK