Protein Info for SO4468 in Shewanella oneidensis MR-1

Annotation: transcriptional regulator, TetR family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF00440: TetR_N" amino acids 12 to 57 (46 residues), 38.3 bits, see alignment 8.9e-14 PF16925: TetR_C_13" amino acids 103 to 182 (80 residues), 29.7 bits, see alignment E=5.6e-11

Best Hits

Swiss-Prot: 42% identical to NEMR_ECOLI: HTH-type transcriptional repressor NemR (nemR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_4468)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E926 at UniProt or InterPro

Protein Sequence (198 amino acids)

>SO4468 transcriptional regulator, TetR family (NCBI ptt file) (Shewanella oneidensis MR-1)
MKTETQSTRQHILDIGYSLIIKQGFSCLGLAQLLKAAEVPKGSFYHYFKSKEQFGEALLT
GYFEQYQVELDSLFANPQLSGFDRQMQYWQKWLHVQQDGCIDQKCLVVKLSAEVADLSEA
MRLVLLKGSAGIIERLTHCIQDGIEDSSICNQDAQATAELLYHMWLGASLMNKLGHSHVA
LTRALVTTESILKHKTVC