Protein Info for SO4453 in Shewanella oneidensis MR-1

Annotation: electron transfer flavoprotein-ubiquinone oxidoreductase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 PF13450: NAD_binding_8" amino acids 12 to 57 (46 residues), 26.1 bits, see alignment 2.5e-09 PF21162: ETFQO_UQ-bd" amino acids 212 to 305 (94 residues), 138.3 bits, see alignment E=3.2e-44 PF05187: Fer4_ETF_QO" amino acids 446 to 546 (101 residues), 167.3 bits, see alignment E=2.7e-53

Best Hits

Swiss-Prot: 68% identical to ETFD_PSEAE: Electron transfer flavoprotein-ubiquinone oxidoreductase (PA2953) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 100% identity to son:SO_4453)

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E940 at UniProt or InterPro

Protein Sequence (549 amino acids)

>SO4453 electron transfer flavoprotein-ubiquinone oxidoreductase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MERESMEFDVVIVGAGPAGLATACRLMQISQDSGKEITVCVVEKGSEVGAHILSGAVFEP
RVLDELFSDWRDNGAPVTTAVTHDEIYLLSSETDSKLMPNAFVPKTMHNEGNYIVSVGNL
CRWLATRAEALGVEIFPGFAASELLFNEDNSVKGILIGDMGVGADGQPKDSFMPGMELHA
KYTVFSEGCRGHLGKQLIAKYHLDNGKTPQHYGLGFKEIWKVPAEQHEQGKVVHTGGWPL
TDGASGGGFLYHMEDNQIAVGLIIDLNYKNPHLSPFDEFQRYKTHPVIAKYLAGGERLTY
GARAITKGGLNSLPKMSFPGGLLIGCDAGTLNFAKIKGTHTAMKSGIVAAETLAKAMMAE
VEGGKDLDCYQTHLEESWLYEELYKSRNFGPAMHKFGTFLGGAFNYIDQNWFGGKFPITL
RDEHPDYAQMAPVSAYSKIDYPKPDGKLSFDKLSSVYLSSTYHEEDQPCHLRLKDNSIPL
GINLTQFNEPAQRYCPAGVYEIVEEAGKPKFVINAQNCIHCKTCDIKDPSQNITWVTPEG
GGGPNYPNM