Protein Info for SO4452 in Shewanella oneidensis MR-1

Name: moaA
Annotation: molybdenum cofactor biosynthesis protein A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 4 to 326 (323 residues), 350.3 bits, see alignment E=4.8e-109 PF04055: Radical_SAM" amino acids 17 to 178 (162 residues), 124.6 bits, see alignment E=7.1e-40 PF13353: Fer4_12" amino acids 22 to 122 (101 residues), 27.8 bits, see alignment E=4.2e-10 PF06463: Mob_synth_C" amino acids 183 to 309 (127 residues), 132.1 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 74% identical to MOAA_SHEDO: GTP 3',8-cyclase (moaA) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to son:SO_4452)

MetaCyc: 58% identical to GTP 3',8'-cyclase (Escherichia coli K-12 substr. MG1655)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E941 at UniProt or InterPro

Protein Sequence (326 amino acids)

>SO4452 molybdenum cofactor biosynthesis protein A (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQLQDNFGRKFHYLRMSVTDVCNFKCSYCLPDGYHPNGKQQFLSLSEIENLVSAFSLVG
TQKIRITGGEPTLRKDFTDIIRVVADNPRIHTVATTTNGYRLEKHAKEWFDAGLRRINVS
VDSLDPKMFYQITGENKFDEVMRGIDAALSAGFERVKVNAVLLKGMNDKDLPRFLNWIKH
TPIDLRFIELMETGLGREYFQAHHLAGADIKALLQAEGWQLDIPSADDGPAQNFSHSDFK
GRIGLIMPYATNFCASCNRLRVSAKGKLHLCLFTESGIDLRDLLQHPSQQAELIERLHGQ
LAQKKETHYLHQGITGVTQHLASIGG