Protein Info for SO4428 in Shewanella oneidensis MR-1

Annotation: DNA-binding response regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00072: Response_reg" amino acids 3 to 111 (109 residues), 83.7 bits, see alignment E=1.1e-27 PF00486: Trans_reg_C" amino acids 147 to 221 (75 residues), 95.4 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 43% identical to CUSR_ECOL6: Transcriptional regulatory protein CusR (cusR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 100% identity to she:Shewmr4_0281)

Predicted SEED Role

"DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E961 at UniProt or InterPro

Protein Sequence (225 amino acids)

>SO4428 DNA-binding response regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MKILLVEDDATTIDYIVKGFLEQGHNIETASDGHQGLLQATSGQYDLLILDRMLPQLDGL
KLLAALRATGNQTPVLILSALAHVDERVKGLRAGGDDYMTKPFAFSELLVRAEKLMQRGQ
STPITTDLVVGGLKMELLTRNVTLDGHDLMLQPKEFQLLKYLMEHANQVISRTLLFEAVW
DYHFDPRTNVIDVHIAKLRRKFEELGHGELIETVRGAGYRLRQRH