Protein Info for SO4425 in Shewanella oneidensis MR-1

Annotation: GGDEF family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 269 to 428 (160 residues), 159 bits, see alignment E=4.4e-51 PF00990: GGDEF" amino acids 272 to 427 (156 residues), 154.1 bits, see alignment E=1.4e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4425)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E963 at UniProt or InterPro

Protein Sequence (435 amino acids)

>SO4425 GGDEF family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFATISLSTALLKSLSNSPSINIQPFQQKCQKPSIVKGKLNVAMEFDPQALLLIKFICLL
TGTAAIAWGLIAQPLKIATLASMRFSLANICVLLGITLNTQRTESDSYFYWFCADIAILL
GFIMLRWGTQYLFRLQHSARFDLTTLAITAVLMLMVPPNFHSEPVLAMLFSANAALSFVM
LTRDNYYAIRRETGNKVAIAMVMPLIAMVIIFAIRFFIALFAPHETQTFIAIHTVEAIPM
LWFYVFLALLINIVMIGNAMTRLVSKIRVLAEKDQLTGLWNRRAMQKRLSHIHQRWQKKA
EPYSVILLDLDHFKHINDHYGHDVGDIALLSAARLFSSALREHDVLCRHGGEEFLVLLPA
TSSQAARVVADKLHRILRENPINWQDKKVQLCASVGYATIYQGCQPDKLLIEADHAMYRA
KSEGRDRICQALTTQ