Protein Info for SO4401 in Shewanella oneidensis MR-1

Name: rbn
Annotation: ribonuclease BN (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 20 to 276 (257 residues), 285.1 bits, see alignment E=3.3e-89 PF03631: Virul_fac_BrkB" amino acids 30 to 277 (248 residues), 221.6 bits, see alignment E=7.1e-70

Best Hits

Swiss-Prot: 100% identical to Y4401_SHEON: UPF0761 membrane protein SO_4401 (SO_4401) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to son:SO_4401)

Predicted SEED Role

"Inner membrane protein YihY, formerly thought to be RNase BN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E985 at UniProt or InterPro

Protein Sequence (295 amino acids)

>SO4401 ribonuclease BN (NCBI ptt file) (Shewanella oneidensis MR-1)
MTKKIDLAQIRVLLLGIWHFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLS
AFPVFKGIRGQIEAFVYENFLPAAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISA
IDKSLNNIWRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGMM
PLFIERLPLLFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFAFYVTKFPS
YEAIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEYLDYESSSNAGETQPLAE