Protein Info for SO4396 in Shewanella oneidensis MR-1

Name: acpD
Annotation: acyl carrier protein phosphodiesterase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02525: Flavodoxin_2
  • amino acids 2 to 195 (194 residues), 164.6 bits, E=2.5e-52
• PF03358: FMN_red
  • amino acids 3 to 169 (167 residues), 57.1 bits, E=1.6e-19

Best Hits

Swiss-Prot: 100% identical to AZOR_SHEON: FMN-dependent NADH-azoreductase (azoR) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 100% identity to son:SO_4396)

MetaCyc: 64% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

See Q8E990 at UniProt or InterPro

Protein Sequence (198 amino acids)

>SO4396 acyl carrier protein phosphodiesterase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKVLVLKSSILGGYSQSALLVDYLIGKWEKQGATITVRDLAGKDVLPMVDGEIASGLRG
GAELTARQQEMLDLSNALVEELKANDTIVITAPMYNFNIPTQLKNWIDFVARAGVTFTYT
ENGPKGLVEGKRAVLITTRGGAHKDGPTDHMVPFLKTFLGFIGITDVDVVYAEALNMGPE
ANQKGISEAKASIDKLAV