Protein Info for SO4388 in Shewanella oneidensis MR-1

Annotation: DNA-binding response regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 110.5 bits, see alignment E=4.9e-36 PF00486: Trans_reg_C" amino acids 150 to 224 (75 residues), 77.7 bits, see alignment E=6e-26

Best Hits

Swiss-Prot: 41% identical to WALR_BACSU: Transcriptional regulatory protein WalR (walR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to son:SO_4388)

Predicted SEED Role

"Putative response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E997 at UniProt or InterPro

Protein Sequence (227 amino acids)

>SO4388 DNA-binding response regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MKILIAEDDIHIRQGLADMLSREGYSVLLADNGKVALLKYQQEQPDFIILDIMMPELDGY
SVCKEIRKHDEQTPVIFLSAKGEELDKVLGLELGADDYINKPFGIHEVRARIKTIARRCL
KAKQNSPDQSFIFGDLTIYPMELCAKRQQQTIELSLREIKILSCLHRYKNQIVTRDMLLD
WVWGVDHLPNSRTLDQHISKLRKMIESDPNTPLLIKTIHGYGYRYQE