Protein Info for SO4378 in Shewanella oneidensis MR-1

Annotation: FAD-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF01494: FAD_binding_3" amino acids 17 to 339 (323 residues), 67.6 bits, see alignment E=4.2e-22 PF04820: Trp_halogenase" amino acids 18 to 91 (74 residues), 40.5 bits, see alignment E=6e-14 amino acids 111 to 367 (257 residues), 33.9 bits, see alignment E=5.9e-12 PF12831: FAD_oxidored" amino acids 18 to 179 (162 residues), 37.1 bits, see alignment E=8.6e-13 PF13450: NAD_binding_8" amino acids 21 to 50 (30 residues), 29.5 bits, see alignment (E = 2.6e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4378)

Predicted SEED Role

"FIG022199: FAD-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9A6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>SO4378 FAD-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSTSTAASATQSYSLCVDVAIIGAGPSGSIAASLLHKQGKRVVVLERQHFPRFSIGESLL
PCCMQFIEEAGMLEALNAAGFQYKNGAAFRRNGVYTTFDFTDKFTPGPGTTFQVQRGNFD
KLLADTAASFGVEIRYGETVEAIDLTAAPRLTVRNEQGELYQVEAKYVLDASGFGRVLPR
LLDLETPSSLPTRSAIFTHVEDNISDPNFDRNKILISVHPLHQDIWYWLIPFSNGRCSLG
VVAEPQLLARLEGDLEQQLLTIVKEEPGLNALLANAKVAQPCATLKGYSANVSRLATDKF
ALLGNAGEFLDPVFSSGVTIAMQSASMAAKCVTKQLNGGTVDWPTEYSAPLMQGVNTFRT
YVQAWYDGRFQDVIFYEDPNPKIKQMICSILAGYAWDVQNPFVKESERRLNMVVELCRQD
AELITAEPAISELAEV