Protein Info for SO4343 in Shewanella oneidensis MR-1
Annotation: aminotransferase, class V (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 36% identical to Y959_METJA: Uncharacterized aminotransferase MJ0959 (MJ0959) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00830, alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC: 2.6.1.44 2.6.1.45 2.6.1.51] (inferred from 100% identity to son:SO_4343)MetaCyc: 36% identical to phosphoserine aminotransferase monomer (Methanocaldococcus jannaschii)
Phosphoserine transaminase. [EC: 2.6.1.52]; Aspartate transaminase. [EC: 2.6.1.52, 2.6.1.1]; 2.6.1.1 [EC: 2.6.1.52, 2.6.1.1]
Predicted SEED Role
"Serine--pyruvate aminotransferase (EC 2.6.1.51) / L-alanine:glyoxylate aminotransferase (EC 2.6.1.44)" in subsystem Photorespiration (oxidative C2 cycle) or Pyruvate Alanine Serine Interconversions or Serine-glyoxylate cycle (EC 2.6.1.44, EC 2.6.1.51)
MetaCyc Pathways
- superpathway of chorismate metabolism (50/59 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- aspartate superpathway (23/25 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
- pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
- superpathway of L-threonine biosynthesis (6/6 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- L-tyrosine degradation I (5/5 steps found)
- superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-serine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- photorespiration II (8/10 steps found)
- TCA cycle VIII (Chlamydia) (5/6 steps found)
- malate/L-aspartate shuttle pathway (2/2 steps found)
- photorespiration I (7/9 steps found)
- photorespiration III (7/9 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-aspartate biosynthesis (1/1 steps found)
- L-aspartate degradation I (1/1 steps found)
- glycine biosynthesis III (1/1 steps found)
- superpathway of L-aspartate and L-asparagine biosynthesis (3/4 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
- L-asparagine degradation III (mammalian) (2/3 steps found)
- L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
- L-phenylalanine degradation II (anaerobic) (2/3 steps found)
- L-glutamate degradation II (1/2 steps found)
- L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-serine biosynthesis II (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
- (R)-cysteate degradation (1/3 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- indole-3-acetate biosynthesis VI (bacteria) (1/3 steps found)
- sulfolactate degradation III (1/3 steps found)
- formaldehyde assimilation I (serine pathway) (8/13 steps found)
- superpathway of plastoquinol biosynthesis (2/5 steps found)
- L-tryptophan degradation VIII (to tryptophol) (1/4 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
- superpathway of sulfolactate degradation (2/6 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- coenzyme M biosynthesis II (1/6 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
- indole-3-acetate biosynthesis II (3/12 steps found)
- rosmarinic acid biosynthesis I (1/10 steps found)
- (S)-reticuline biosynthesis I (1/11 steps found)
- superpathway of rosmarinic acid biosynthesis (1/14 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Cysteine metabolism
- Glutamate metabolism
- Glycine, serine and threonine metabolism
- Novobiocin biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
- Vitamin B6 metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.1, 2.6.1.52
Use Curated BLAST to search for 2.6.1.1 or 2.6.1.44 or 2.6.1.45 or 2.6.1.51 or 2.6.1.52
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8E9E1 at UniProt or InterPro
Protein Sequence (378 amino acids)
>SO4343 aminotransferase, class V (NCBI ptt file) (Shewanella oneidensis MR-1) MMLPAPHFSAFNPPRRILMGPGPSDVYPEVLAAQARPTVGHLDPLFVSMMDELKSLIQYA FQTKNEMTMAVSAPGSAGMETCFVNLVEPGEKVIVCRNGVFGERMRQNVERVGAIAVLVD NEWGTPVDPVAVEAALKAHPDAKFLAFVHAETSTGALSDAKTLCALAKQYGCLSIVDAVT SLGGVELRVDEWGIDAIYSGSQKCLSCVPGLSPVSFSPAAVEKLKNRKTPVQSWFLDQSL VMAYWTSAGGKRSYHHTAPVNALYAMHESLRILAAEGLENAWKRHQDMHLVLRAGLEKLG LKFVVAEASRLPQLNAIYIPEGVDDAAVRARLLKDYNLEIGAGLGALAGKAWRIGLMGFG ARRENVALCLRALEEVLN