Protein Info for SO4339 in Shewanella oneidensis MR-1

Annotation: sodium-dependent transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 98 to 126 (29 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 360 to 385 (26 residues), see Phobius details amino acids 391 to 408 (18 residues), see Phobius details amino acids 436 to 453 (18 residues), see Phobius details PF00209: SNF" amino acids 10 to 128 (119 residues), 71.4 bits, see alignment E=3.3e-24 amino acids 157 to 451 (295 residues), 95.7 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 100% identity to son:SO_4339)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9E5 at UniProt or InterPro

Protein Sequence (454 amino acids)

>SO4339 sodium-dependent transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MQSANTNSTNHFSSRLGFIMAAAGSAVGVGNIWGFPTQAATHGGGAFLLVYLVLIFILGI
PMLMAELMIGRHGQTNPADAMGKLGCNSLTRSLGKTIGLISIVTAGLIYTFYSILSGWFV
SFAIAPIATAFGSNDTAAWLMDFSLSRNLVFTLIFSTLVFLVLLQGVQEGIEKWSKRLMP
LLLIMLIAGVAYIFSLNGASEGISALLTPNFAKAIAPDTLINALGQTFFSLTIGTGAMMV
YGSYLSQKENIAKLTVWVAFTDSGIAFLAAFLIIPAMYVAQHNGVQIFSPEGKLIDSDAL
VFTVLPALFSTLGDTANLIISVVFFMLLIIAGLTSAISIAEVPTSYVMQKCGFSRQRATL
IIGLLLTALSLLLAVFFETLFSFTIMLTTQMTQPLVALGIAIYLGWIWRQSQLLKAISKQ
EGVDATGLFWRIWPRYVKYVCPVLIIAIAIRQFV