Protein Info for SO4327 in Shewanella oneidensis MR-1

Annotation: HlyD family secretion domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 44 to 357 (314 residues), 253.7 bits, see alignment E=1.1e-79 PF16576: HlyD_D23" amino acids 57 to 269 (213 residues), 94.9 bits, see alignment E=8.8e-31 PF13533: Biotin_lipoyl_2" amino acids 70 to 103 (34 residues), 31.6 bits, see alignment 2.3e-11 PF13437: HlyD_3" amino acids 166 to 266 (101 residues), 66.9 bits, see alignment E=4.7e-22

Best Hits

Swiss-Prot: 42% identical to Y894_HAEIN: Uncharacterized protein HI_0894 (HI_0894) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to son:SO_4327)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9F6 at UniProt or InterPro

Protein Sequence (372 amino acids)

>SO4327 HlyD family secretion domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKWTLSMLAIAVLAFGSVIGFNLMVKSKIADAIANMPEAEFPVTAMALEMQKWQPTIDA
IGFVEPHQGVTISNELAGRVTSINFENGSRVEKGQLLAELDAKVERANLKSKMVQLPAAE
ADFKRLSKLYAQKSVSKQDLDNSESKYLALQADIESLKATIERREISAPFSGLVGIRNIN
LGEYLQPGTDIVRLEDISTMKIRFTIPQTQLPRIAVGQKIHVFVDSYPEQPFEGEIAAIE
PAVFYQSGLIQVQARIPNDNAKLRSGMFARVSILLPELNDQFVLPQTAINFTLYGNSIYL
IKDVEENGKKLARVEQINLTVLERNGNNALVSGALKAGDRIVTSGQIRLSNNSKVTVVED
QALIHSDTMPKL