Protein Info for SO4320 in Shewanella oneidensis MR-1

Name: aggA
Annotation: agglutination protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 28 to 451 (424 residues), 334 bits, see alignment E=6.9e-104 PF02321: OEP" amino acids 32 to 225 (194 residues), 112.3 bits, see alignment E=1.3e-36 amino acids 251 to 442 (192 residues), 92.9 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: K03287, outer membrane factor, OMF family (inferred from 100% identity to son:SO_4320)

Predicted SEED Role

"Type I secretion system, outer membrane component LapE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9G3 at UniProt or InterPro

Protein Sequence (471 amino acids)

>SO4320 agglutination protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKTLVRRQFQCSKIAVLLSAILLPLSAQSQTLEQAVAHTLDTNPDLRVAFNRFKAREEQV
NQAIAGYMPTVDLTGGYGYEQTDSVSTRRRKNVGDVDSNGVAELNRGEFGISLKQMLFDG
FYTSSEVDRYSFEASADQWALLAAAEDMALDVSKAYLNYLRTDEVLKLAEKNLNSHKEIY
DQIKQRTDSGLGSTADLSQISGRLARANANVISARNNLLDAKAQFVRVVAADPVDLIQPV
PDADMLPKDLNSSIADAEKNHPILKSAANDIRAAENERSSTQANYYPQVSLELNGSWNND
VGGEDGVSAIASQNVGGYSNDIVAMVRVKYNLFAGGKDLAREKESAYKLSEAKEIRQRAQ
REVVEGVNLAWNAYEMLAPQKQYIRDHVIAAKDTQSAYAQQFNLGQRSLLDLLDTENELF
EARKDYLQAEYDETIAKYRVLNSTGRLLDSLKVTRPEAWRGERNYEGGANQ