Protein Info for SO4319 in Shewanella oneidensis MR-1

Annotation: HlyD family secretion protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 54 to 72 (19 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 50 to 484 (435 residues), 527 bits, see alignment E=1.9e-162 PF00529: CusB_dom_1" amino acids 63 to 453 (391 residues), 28.2 bits, see alignment E=2.9e-10 PF13533: Biotin_lipoyl_2" amino acids 92 to 135 (44 residues), 27.8 bits, see alignment 3.4e-10 PF13437: HlyD_3" amino acids 335 to 433 (99 residues), 54.3 bits, see alignment E=4.1e-18

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to son:SO_4319)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9G4 at UniProt or InterPro

Protein Sequence (484 amino acids)

>SO4319 HlyD family secretion protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLLMVLKLKCWKNSILALLTEALKMSKNLTANDLDMVDDVYGAMMTDAPSGHRLIIWALA
AMVACFLLWAGFAELDTVTTGSGKVIPSSQVQVIQSLDGGIMQELFVRDGDLVTKGQPLV
RIDDTRFRSDFAQQEQEVFGLKTNAIRMRAELDSILISDMTSDWREQVKITKKDLVFPDS
IIQAEPALVKRQQEEYSGRLDNLSNQLEILVRQIQQRQQEIDDLASKTTTLTTSMQLISR
ELELTRPLAKKGIVPEVELLKLERAVNDAQGELNSLRLLRPKLKAALDEAILKRREAVFV
YAADLRAQLNETQTRLSRMNEAQVGAQDKVSKAIITSPVNGTIKTVHINTLGGVVQPGVD
IIEIVPSEDQLLIETKILPKDIAFLHTGLPAVVKVTAYDFTRYGGLKGTVEHISADTSQD
EEGNSFYLIKVRTEESSLIKDDGTQMPIIPGMLTTVDVITGQRSILEYILNPILRAKDTA
LRER