Protein Info for SO4308 in Shewanella oneidensis MR-1

Name: dapF
Annotation: diaminopimelate epimerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00652: diaminopimelate epimerase" amino acids 2 to 274 (273 residues), 327.5 bits, see alignment E=3.3e-102 PF01678: DAP_epimerase" amino acids 4 to 123 (120 residues), 117.5 bits, see alignment E=3.6e-38 amino acids 153 to 268 (116 residues), 115.5 bits, see alignment E=1.6e-37 PF02567: PhzC-PhzF" amino acids 48 to 227 (180 residues), 28.1 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 100% identical to DAPF_SHEON: Diaminopimelate epimerase (dapF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to son:SO_4308)

MetaCyc: 69% identical to diaminopimelate epimerase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9H5 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SO4308 diaminopimelate epimerase (NCBI ptt file) (Shewanella oneidensis MR-1)
MIQFTKMHGLGNDFMVVDGITQNVFFSPEQIRRLADRNFGVGFDQLLLVEPPYDPDLDFH
YRIFNADGGEVENCGNGARCFARFVRNKGLTNKNKIRVSTSAGKMTLRLERDGTVTVNMG
VPVLEPSQIPFKAKKAEKTYLLQTPQQTFLCGAASMGNPHCVLDVEDVANANVAEIGALL
TKHERFPRGVNVGFMQVVNAGHIKLRVYERGAAETLACGTGACAAVVVGQIQGKLDQQVQ
VDLPGGSLTINWEGEGKPLWMTGPAQHVYDGQIQL