Protein Info for SO4296 in Shewanella oneidensis MR-1

Annotation: NupC family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 54 (26 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF01773: Nucleos_tra2_N" amino acids 6 to 79 (74 residues), 70.7 bits, see alignment E=1.8e-23 PF07670: Gate" amino acids 92 to 190 (99 residues), 61.6 bits, see alignment E=1.3e-20 PF07662: Nucleos_tra2_C" amino acids 195 to 397 (203 residues), 228.5 bits, see alignment E=1.2e-71

Best Hits

Swiss-Prot: 48% identical to Y519_HAEIN: Uncharacterized transporter HI_0519 (HI_0519) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to son:SO_4296)

Predicted SEED Role

"Na+ dependent nucleoside transporter NupC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9I4 at UniProt or InterPro

Protein Sequence (401 amino acids)

>SO4296 NupC family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MIQSILGIFVLLGVGLLFSDNRSLISWRAVIGAFGIIIALAFFVLATEIGADVLLAVSNT
VGKVFGYGTEGIKFAFGSLVNFSVEGIGFVWALQVLPQIIFTAALTSLLYYLGIMQWFVL
IIGGSLQKVLGTSRAESMNAAGNIILGQTEAPLLIKPYHRVLTRAQIFAVMVGGLSSIAG
SILAGLAGMGVALNYLIMACFMSAPAGLMFAKLLIPETEPTVNEVPELPDDEKPSSFIDA
IAKGAIAGMGIAAIVGAVIIACIGLMALLNGGLGAIGELFGMPTLTVDMILGTLFAPVAW
LIGIPWVEASTAGAFLGQKIAMNEFVAFANMGNVELSARSNAIMTIALCGFANIGSVAMV
CGALSKMIPQRAGLIGQLGMKVLLAATLANLMNAAIVSLFI