Protein Info for SO4292 in Shewanella oneidensis MR-1

Name: pstS
Annotation: phosphate ABC transporter, periplasmic phosphate-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 20 to 267 (248 residues), 302 bits, see alignment E=2.1e-94 PF12849: PBP_like_2" amino acids 21 to 254 (234 residues), 151.7 bits, see alignment E=7.1e-48 PF13531: SBP_bac_11" amino acids 24 to 265 (242 residues), 50.5 bits, see alignment E=4.9e-17 PF12727: PBP_like" amino acids 47 to 203 (157 residues), 44.2 bits, see alignment E=2.6e-15

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to son:SO_4292)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9I5 at UniProt or InterPro

Protein Sequence (269 amino acids)

>SO4292 phosphate ABC transporter, periplasmic phosphate-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNKYINLLTAIGLLVAPFAQASTVTVSGSTSVAHLMEVLAENFQKITTHSVEVQSTGSSA
GIQAAINGTSMIGMSSRNINENELNDTTKAIVIAHDGIAAAVNNANPVQDLTQEQISKIY
RGEIKNWREVGGESRPIVVVTREAGSGTRGAFEEIMKLQRTINGHKVSAITPKAHVGSGN
GMIKTIVANNPYAIGYISLGSVDNSLRAIKVNGVIASDQNIATGQYQITRPFILLVNNKP
HQNAQDFIDFIISNDGQRIVAEQGYSPTK