Protein Info for SO4290 in Shewanella oneidensis MR-1

Name: pstA
Annotation: phosphate ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 59 to 88 (30 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 13 to 277 (265 residues), 290.7 bits, see alignment E=4.6e-91 PF00528: BPD_transp_1" amino acids 79 to 275 (197 residues), 75.2 bits, see alignment E=2.8e-25

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to son:SO_4290)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9I7 at UniProt or InterPro

Protein Sequence (278 amino acids)

>SO4290 phosphate ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLTRKRKDRLLYCAIWGSAGITILFLLWVVWHILANGLSHVSWEFITGAYTRIGEISGIW
AMIVSTVYMVLLSLTFAAPIGIMTAIYLTEYASPVSKVVRVIRFCTESLAGIPSIVYGLF
GMTFFVTQLGLGFSILSGALTLAMLILPVIIRTTEEALMSVPMSYREGGYALGCSKIYII
WRLILPSALPGIVNSIILSTGRVVGESAPVFLTAGMVTQIPESVMDSGRTLTVHLYKLTQ
ELFTQNEWDQAYATATILIVLVLMLNLATKLIATKLNK