Protein Info for SO4289 in Shewanella oneidensis MR-1

Name: pstB-2
Annotation: phosphate ABC transporter, ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF20703: nSTAND1" amino acids 2 to 47 (46 residues), 29.9 bits, see alignment 7.1e-11 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 4 to 249 (246 residues), 423 bits, see alignment E=1.7e-131 PF00005: ABC_tran" amino acids 19 to 174 (156 residues), 110 bits, see alignment E=2.3e-35 PF13304: AAA_21" amino acids 112 to 204 (93 residues), 33.6 bits, see alignment E=7e-12

Best Hits

Swiss-Prot: 100% identical to PSTB2_SHEON: Phosphate import ATP-binding protein PstB 2 (pstB2) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to son:SO_4289)

MetaCyc: 55% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9I8 at UniProt or InterPro

Protein Sequence (249 amino acids)

>SO4289 phosphate ABC transporter, ATP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKFEVTHLNLFYGENHALKDISIDIPARQVTALIGPSGCGKSSLLRTLNRMNDLVEGVK
ITGTVTFDGDDIYANIDVKHLRMSVGMVFQKPNPFPMSIYENIAFGLKAQGVKDKAVLDA
VVENSLRGAALWEEVKTRLHTPAFGLSGGQQQRLCIARAIAMEPEVILMDEPTSALDPIA
THKIEELMDELRKKFTIVIVTHSMNQAKRISDKTAFFWMGELVEHGDTEQIFNNPKDHRT
QGYVSGHFG