Protein Info for SO4255 in Shewanella oneidensis MR-1

Name: pyrE
Annotation: orotate phosphoribosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00336: orotate phosphoribosyltransferase
  • amino acids 10 to 187 (178 residues), 218.8 bits, E=2.1e-69
• PF00156: Pribosyltran
  • amino acids 46 to 161 (116 residues), 43.1 bits, E=1.4e-15

Best Hits

Swiss-Prot: 100% identical to PYRE_SHEON: Orotate phosphoribosyltransferase (pyrE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 100% identity to son:SO_4255)

MetaCyc: 79% identical to orotate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

See Q8E9L5 at UniProt or InterPro

Protein Sequence (215 amino acids)

>SO4255 orotate phosphoribosyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKAYQREFIEFALERQVLRFGEFTLKSGRISPYFFNAGLFNTGRDLARLGRFYAAALVDS
GIDYDLLFGPAYKGIPIATTTAVALCEHHNIDIPYCFNRKEKKDHGEGGSLVGSELKGRV
MLVDDVITAGTAIRESMEIIEAHQAQLAGVLIALDRQEKGKGELSAIQEVERDFGCGIVA
IIKLADLISYLSEKPRMEAQLAAVSQYREQYGIEA