Protein Info for SO4247 in Shewanella oneidensis MR-1

Name: rpmB
Annotation: ribosomal protein L28 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 TIGR00009: ribosomal protein bL28" amino acids 1 to 57 (57 residues), 98.8 bits, see alignment E=9.2e-33 PF00830: Ribosomal_L28" amino acids 3 to 62 (60 residues), 100.5 bits, see alignment E=2e-33

Best Hits

Swiss-Prot: 100% identical to RL28_SHEB2: 50S ribosomal protein L28 (rpmB) from Shewanella baltica (strain OS223)

KEGG orthology group: K02902, large subunit ribosomal protein L28 (inferred from 92% identity to sse:Ssed_0386)

MetaCyc: 79% identical to 50S ribosomal subunit protein L28 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L28p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9M3 at UniProt or InterPro

Protein Sequence (78 amino acids)

>SO4247 ribosomal protein L28 (NCBI ptt file) (Shewanella oneidensis MR-1)
MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRLID
KKGIEVVVAELRARGEKV