Protein Info for SO4243 in Shewanella oneidensis MR-1

Name: rarD
Annotation: rarD protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 260 (253 residues), 287.7 bits, see alignment E=4.1e-90 PF00892: EamA" amino acids 8 to 142 (135 residues), 54.2 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 58% identical to RARD_SALTI: Protein RarD (rarD) from Salmonella typhi

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to son:SO_4243)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9M6 at UniProt or InterPro

Protein Sequence (294 amino acids)

>SO4243 rarD protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPDTEYRKGILLAVSAYCMWGFAPLYFKLLHHVSATEILLHRVIWSFVFMVIIMMFIGGF
GKLRQLFKQPKQLIVLTITSLLIAGNWLLFIWAVNNDHMLDASLGYFINPLLNVLLGMLF
LGERLRKLQWFAVALASAGVLIQLISFGSIPIVSLALAGTFGLYALLRKKVNVDAKSGLL
VETAILLPVALVYLVATLDSATANMLTNDWHLNLLLMAAGIVTTIPLLCFAGAAVRIPLS
MLGFFQYIGPSIMFILAVTLFNEPFDAEKSITFGFIWSALLVFTFDMAYKRKTS