Protein Info for SO4224 in Shewanella oneidensis MR-1

Name: murE
Annotation: UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 300 to 318 (19 residues), see Phobius details TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 21 to 487 (467 residues), 508.8 bits, see alignment E=8.1e-157 PF01225: Mur_ligase" amino acids 22 to 96 (75 residues), 43.7 bits, see alignment E=4.5e-15 PF08245: Mur_ligase_M" amino acids 112 to 315 (204 residues), 188.2 bits, see alignment E=2.6e-59 PF02875: Mur_ligase_C" amino acids 338 to 464 (127 residues), 117.1 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 100% identical to MURE_SHEON: UDP-N-acetylmuramyl-tripeptide synthetase (murE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 100% identity to son:SO_4224)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9P3 at UniProt or InterPro

Protein Sequence (491 amino acids)

>SO4224 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (NCBI ptt file) (Shewanella oneidensis MR-1)
MLLRELLAPWFPYAGEQTFLDLTLDSRAIRRGDVFLALPGHKVDGRQFIDKALAQGATAV
LVHTDNPQEQGKVIVAEQGVQIYFYELAKHVSAVAAVRYPVIQGHAMGIVGITGTNGKTS
TSQLCAQLVTLLSGKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHEFANKGVNTCAM
EVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMENYAAAKQMLFRFDSLRHGLLNLD
DPIGGAWLAELKNVPAKIWGFSIEAHKAAAFYTKNVRFNDQGVQATLVWPEGEIDISSPL
LGAFNLSNLLAALSALYLQGMDMRALAAKVPYLVPVAGRMERFTTADNITLVVDYAHTPD
AIEQALNALRRHCAGVLWCVFGCGGDRDKGKRPLMGQAAEQFADRIMVTSDNARSEDPNQ
IITDIIQGLTHPERALTEVDRVAAIKQVVAQAKSGDVILLAGKGHETYQEAAGVRHDYDE
RALARQLSEQS