Protein Info for SO4216 in Shewanella oneidensis MR-1

Name: ftsA
Annotation: cell division protein FtsA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 TIGR01174: cell division protein FtsA" amino acids 9 to 378 (370 residues), 507.3 bits, see alignment E=1.3e-156 PF02491: SHS2_FTSA" amino acids 85 to 162 (78 residues), 109.6 bits, see alignment E=2e-35 PF06723: MreB_Mbl" amino acids 203 to 353 (151 residues), 59.1 bits, see alignment E=8.9e-20 PF14450: FtsA" amino acids 207 to 374 (168 residues), 125.1 bits, see alignment E=5.8e-40

Best Hits

Swiss-Prot: 60% identical to FTSA_ECO57: Cell division protein FtsA (ftsA) from Escherichia coli O157:H7

KEGG orthology group: K03590, cell division protein FtsA (inferred from 99% identity to sbm:Shew185_0404)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9Q0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>SO4216 cell division protein FtsA (NCBI ptt file) (Shewanella oneidensis MR-1)
MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS
VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK
IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL
KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT
NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR
YQELFELVLKELKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVASPLPVKGL
YEYVDQSIYSTGVGLLHYGARRVLERQFERPERQGVTSAWNRVQSWFKGEF