Protein Info for SO4201 in Shewanella oneidensis MR-1

Name: aarF
Annotation: ubiquinone biosynthesis protein AarF (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 transmembrane" amino acids 499 to 516 (18 residues), see Phobius details amino acids 522 to 540 (19 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 7 to 445 (439 residues), 547 bits, see alignment E=1.3e-168 PF03109: ABC1" amino acids 93 to 342 (250 residues), 239.4 bits, see alignment E=3.3e-75 PF27536: UbiB_N" amino acids 364 to 423 (60 residues), 90.2 bits, see alignment 5.1e-30

Best Hits

Swiss-Prot: 100% identical to UBIB_SHEON: Probable protein kinase UbiB (ubiB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to son:SO_4201)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9R5 at UniProt or InterPro

Protein Sequence (549 amino acids)

>SO4201 ubiquinone biosynthesis protein AarF (NCBI ptt file) (Shewanella oneidensis MR-1)
MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFTLARNSLFWIRNKHKDKSGGERLKLA
MQELGPVYIKLGQMLSTRRDLLSDEWATELAMLQDKVPPFDGALARLAIEAELKAPIETF
FDDFNETPLASASISQVHTATLKSNGKAVVLKVLRPNVETKIQADLLLMSQTAKVIDYLL
GEGNRLRPAEVIEDYRVTILGELNLKLEALNAIKLRNNFIDSDALYIPYVYEEFCYPRLM
VMERIYGIPVSDIVALKAQGTNFKLLAERGVELFFTQVFRDNFFHADMHPGNIFISRENP
ENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYIESGWVSEKTDLQAFEQ
AIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLLEKTLLYIEGLGRQLYP
QLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFPELIYDNLKLGRKLLSS
QQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLLFNQDATLLSPYVCLISGAVLWIIGW
RSRPKNRKF