Protein Info for SO4191 in Shewanella oneidensis MR-1

Annotation: DedA family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 28 to 143 (116 residues), 69.5 bits, see alignment E=1.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4191)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9S5 at UniProt or InterPro

Protein Sequence (192 amino acids)

>SO4191 DedA family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTPWLQQYGYLLLFIAIAVEGFGIPAPGQSLLIVASLLAATGQMSLSLVLLVATFAALCG
NTLGYFIGRRFGDVLLKKGWIKPKVEDKIHAVIGQYGIAALVLSRFVEGLKQFMFIGCGL
AKMPFRKFVMGNLLATSIWVSLFGLGPVLIRDEIAPILAFYHQHKYPTWAIVSLMLMALL
LFTWRKWQVKNQ