Protein Info for SO4174 in Shewanella oneidensis MR-1

Annotation: NAD dependent epimerase/dehydratase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 3 to 292 (290 residues), 228.7 bits, E=2.5e-71
• PF01370: Epimerase
  • amino acids 4 to 185 (182 residues), 106.3 bits, E=5.1e-34
• PF16363: GDP_Man_Dehyd
  • amino acids 5 to 149 (145 residues), 49 bits, E=1.9e-16
• PF02719: Polysacc_synt_2
  • amino acids 47 to 150 (104 residues), 27.6 bits, E=5.2e-10

Best Hits

Swiss-Prot: 44% identical to MAT2B_XENTR: Methionine adenosyltransferase 2 subunit beta (mat2b) from Xenopus tropicalis

KEGG orthology group: None (inferred from 100% identity to son:SO_4174)

MetaCyc: 43% identical to Methionine adenosyltransferase 2 subunit beta (Homo sapiens)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• S-adenosyl-L-methionine salvage I (4/4 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage II (2/3 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• L-methionine degradation I (to L-homocysteine) (1/3 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)
• superpathway of L-methionine salvage and degradation (4/16 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Polyketide sugar unit biosynthesis
• Selenoamino acid metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.133, 2.5.1.6

Use Curated BLAST to search for 1.1.1.133 or 2.5.1.6

Sequence Analysis Tools

See Q8E9T9 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SO4174 NAD dependent epimerase/dehydratase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MANIMVTGATGLLGRAVVKQLTAAGHRVIATGFSCAEANIHKLDLTQAIAVEAFIARERP
EVIVHCAAERRPDVSEQSPEQALALNLSASQTLAKAAKQHGAWLLYISTDYVFDGTTPPY
AEDAAPNPVNFYGESKLQGETCVLNTDSRFAVLRLPILYGEVTQLSESAVLVLINQLLDS
RPQRVDAWAIRSPTSTADIAGAIAKLIKRQLHAADVLGIYHFSSPQTMTKYQMLLSLGEL
LAIDTAHLTPELTPMDSAKRPQNCTLSCGRLAALGIYSELEFSAGLNQALAQSSAALAAV
GLKLKE