Protein Info for SO4153 in Shewanella oneidensis MR-1

Annotation: N-ethylmaleimide reductase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00724: Oxidored_FMN
  • amino acids 4 to 340 (337 residues), 299.3 bits, E=2.2e-93

Best Hits

KEGG orthology group: K10680, N-ethylmaleimide reductase [EC: 1.-.-.-] (inferred from 100% identity to son:SO_4153)

Predicted SEED Role

"N-ethylmaleimide reductase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See Q8E9V9 at UniProt or InterPro

Protein Sequence (378 amino acids)

>SO4153 N-ethylmaleimide reductase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSVFTAYESGALTLQNRIVMAPMTRARTTQPGNIPNDLMVQYYAQRSSAGLIITEATQIS
NDSQGYSFTPGVYTEAQIDGWKKVTAAVHEAGGKIFNQIWHVGRVSHPIFQQGNAPIAPS
AIAPVGTKVWIVDEAHPEGQMVDCPEPREMTQADIDRVVADFAKAGANAIAAGFDGIEIH
GGNGYLIDQFLRTNSNHRTDAYGGSPEKRIRFLLEVVEAVSAQIGADKVGVRLAPYVTFK
DMACPEIVETILLAAKQLSAFGVAYLHLSEADWDDAPQIPESFRIELRNVFKGSIIVAGR
YDVERANDVIEKGYADLVAFGRAFIANPDLPYRLANQLPLSPFDKGPLFGGSAAGYTDYP
SYQAALRAVIRSSDDEVA