Protein Info for SO4147 in Shewanella oneidensis MR-1

Annotation: ABC transporter, ATP-binding/permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 transmembrane" amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 263 to 292 (30 residues), see Phobius details amino acids 359 to 383 (25 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 143 to 399 (257 residues), 58.7 bits, see alignment E=1.1e-19 PF00005: ABC_tran" amino acids 469 to 619 (151 residues), 72.4 bits, see alignment E=8.6e-24

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to son:SO_4147)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9W5 at UniProt or InterPro

Protein Sequence (694 amino acids)

>SO4147 ABC transporter, ATP-binding/permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MHNQAQSVPNLKSLLVTLFTQLGLNAQAKNIERSALVDDASYLDAYVLFKKHHVVADLRS
IDPETLSHTIYPFLILPEEGEPQIGRRNQHTFEYLGPHNQWQPITLPSDGKVFIINSLPS
LNQKRSRFASQFKQQKKWFKPVFLLSLVASLTGLAIPLFTMAVYDRVIGGQAPNILPGIA
IGAFLALSIFISSRLLRAKVLASASNKLARDLSAVSFNQLLSMPLMMLSRVGLSNHLARL
RNAEKVRGLLSGPSGGGLIDLPFTIVALIAITVLSGWLVLVPLCMLILFYLVMKALNRYT
QATSPTISNDYQNSLNELAKNVLELKTAGETEGWYADFIRRCREHCRQQFIYAKRNGLNA
AVAHAMGLITALVTVFCGIFLVLNQSISPGALIACGMLIWRITGPAQLAFSSAPKINMIN
STVTQFDRFMEVTTEFNQLRLDGPNLNKAPALNFKHVTLRYTAEAEPALSGVTFDVEAGE
TVAIIGPNGSGKSTLLLTAVGVIDTQAGFVTLDGKNLKQFDPEALRQWAAFSPTHTELLP
GSLADNLRLAKPDATDEELCQALYEAGGDALKEVLGGDLHRSLSAQGANMFSVVGSGYIS
LARALLKKSPLLVMDEPIANRNPFAKKTFIETLTKLKGKTTILFTSHDQELIQHADKVVI
LDKGSVVYAGPIPNKPAASDENQSMASMETTHNE