Protein Info for SO4110 in Shewanella oneidensis MR-1

Annotation: MSHA biogenesis protein MshN, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details PF13432: TPR_16" amino acids 247 to 300 (54 residues), 17.5 bits, see alignment 1.7e-06 amino acids 282 to 335 (54 residues), 18 bits, see alignment 1.2e-06 amino acids 350 to 405 (56 residues), 20 bits, see alignment 2.8e-07 PF14559: TPR_19" amino acids 254 to 308 (55 residues), 25.7 bits, see alignment 4e-09 PF13181: TPR_8" amino acids 378 to 407 (30 residues), 12.6 bits, see alignment (E = 4.6e-05)

Best Hits

KEGG orthology group: K12284, MSHA biogenesis protein MshN (inferred from 100% identity to son:SO_4110)

Predicted SEED Role

"MSHA biogenesis protein MshN" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9Z9 at UniProt or InterPro

Protein Sequence (429 amino acids)

>SO4110 MSHA biogenesis protein MshN, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSVINKMLQDLDKRQQGHSLSNITVNQAQYLGRTSSSRKWLAICLLSLLLGGLSMYAFQA
SYRSQQTTIIPSNTVATPSTHQLESSSQSSVPIEATTNTASIATTTEVVQTKPQQSTGTQ
ASDKLDTSVAQPSPTDKATLEATSQSVPALAKESSAPVSAVNLPSANVAQAQASDTNRLI
DRAKVHQTEPNATVSNQTAQVAPEPSQAKATANEQAEFTGVQSKAAGQMAVKEVKLSPSQ
LAQKQVALASDAEKQGQLLKAMGYYDKALKLDPSLHEARKQLAALHYGQGELAQAAEVLS
QGRLLYPQEYEFYLLLARIQHAMGDTDLALASLAQIPDRHVLARQKWLAQTDLAQKQGQF
TLVEQAYRQLLQQEPQQAKLWMGLAYALDSQQHFAQASQAYRTALSYSGLSTQATAFIEQ
RLLQLGDSQ